SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|256397557|ref|YP_003119121.1| from Catenulispora acidiphila DSM 44928

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|256397557|ref|YP_003119121.1|
Domain Number 1 Region: 15-340
Classification Level Classification E-value
Superfamily Pectin lyase-like 2.04e-29
Family Pectate transeliminase 0.033
Further Details:      
 
Domain Number 2 Region: 495-560
Classification Level Classification E-value
Superfamily PKD domain 0.000000209
Family PKD domain 0.0052
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|256397557|ref|YP_003119121.1|
Sequence length 905
Comment cell wall binding repeat 2-containing protein [Catenulispora acidiphila DSM 44928]
Sequence
MSTLAAAGLAPLSPAHAAPATGSTFYVGGTTGASCSDSNPGSATAPFCSFSKALDAAGPG
DTIAVYSLPSTQEMDVTKSGTPGAPITIEGVPDKFGRIPSVFFNTHLAVVDGQHDIVIEG
FEAHDNLSSRTAGTAIVVSGGSSDVTLTRNHIEGGGGAAGITLSGGATGDVVAGNHIEGS
LDGVTVTDSPGNAVTGNTLTSDSNVGIGLYGTSTGTTVANNISETTQTAATGRPAEISVD
TAAESGAAIHHNILFPAPSSTDPDTGRPIPAGAAYSWGGVAYTDVASFAANSGQGAHDLV
ADPRLNPANDEPLPGSPAIDSADSSAAGALPTDYRGNPRRDDPQVTDSGTGPATDYDRGA
AEYQGGPVTAFSFSITGDATSETISIDARATVAGFTPVASYTANFNGTQVTSSDPVFSHT
FAVSSDPAQTKDQTLDVTATGADGQVGSKAEQDYELGTVIQPTPALTVAADPSTPGGVIA
DPTASTPAIDPVNGGSGSFINEYFIDWGDGSDQWVENAPVTSPVPHAYAKSGTYPVKLTV
ETGTLQSASVAHDITVTVPPPVTTPPVTTPPPTGTPTGPAGPAGPIGPTAPSGTAGHATV
TRLGGGTRYGTALDVSAAQWKDGAAGGVVIARGDAAPDALAGVPLAAHVHGPLLLTDPKA
LDGATTAEIKRVLGADRSKNVYLLGGTTAVSPLVQSQLTALGYQVHRIGGTDRFDTALRV
ARDGLGSTANVVVATGTDFADALAAGPLAASQNAAVVLSDGPVLDPATAAFVNAHSHVTA
VGGAAVKAVAKAAPGKAATDLSGGDRYATAAKVAEAMSTSAGHAPAAAGLASGTVFPDAL
TGGAYAANAGIPLLLTDPKRLPPNVAALFATWKQQLAAIEIFGGPAAVSPAVQSAVATAV
GGHIG
Download sequence
Identical sequences C7PX23
479433.Caci_8457 gi|256397557|ref|YP_003119121.1| WP_015797005.1.73754

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]