SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|256397697|ref|YP_003119261.1| from Catenulispora acidiphila DSM 44928

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  gi|256397697|ref|YP_003119261.1|
Domain Number - Region: 171-236
Classification Level Classification E-value
Superfamily PKD domain 0.0432
Family PKD domain 0.0086
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|256397697|ref|YP_003119261.1|
Sequence length 276
Comment ATP/GTP-binding protein [Catenulispora acidiphila DSM 44928]
Sequence
MSGAALIVATVVAGLRFEDGSQDSSWGGVSEAGRTVYVSARQAETSPQKGNSRGGAPIHD
CALVPDPSHGGQPSGNSGGAAGSWYQWRCQDSSDQQNLTAIPKNDLETWVPTPTMSPGDV
AQAAAKEIHLPAPAMNTSPRDGVPQWVNFPMFLWTDSLDWHPLSATANVPGLQASATATP
EKLTWDMGDGSVVTCTGPGTPFTDSTPATSVSPDCGYVYRRASDAESSGEFTVRVTESWR
VTWTGGGQSGTLPDLAATSSIAVRVAESQALVTSVH
Download sequence
Identical sequences C7PYU8
gi|256397697|ref|YP_003119261.1| 479433.Caci_8601

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]