SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|256397820|ref|YP_003119384.1| from Catenulispora acidiphila DSM 44928

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|256397820|ref|YP_003119384.1|
Domain Number 1 Region: 52-136
Classification Level Classification E-value
Superfamily PKD domain 0.000000000288
Family PKD domain 0.0041
Further Details:      
 
Domain Number 2 Region: 174-242
Classification Level Classification E-value
Superfamily PKD domain 0.00000262
Family PKD domain 0.0099
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|256397820|ref|YP_003119384.1|
Sequence length 554
Comment PKD domain-containing protein [Catenulispora acidiphila DSM 44928]
Sequence
MHVTNKVRLALAAVAASAVSMGVAAPSFAADAPASTATPAPIPVPIGPVWAQLQIHSDSG
SANPLATDFVIQAKDTMPGAKLTYTLDFGDGSSPVSGPVIAGSSGTVTVQHIYKATGTYP
VKLSVSDGTHSVDLAKSYTASVSRQGPTAAVTVTTSPESLTALADLSQCAPAAVPAEQSI
ALIRLNWGDGSSTDIRTPTARVLQIPVAHTYKAAGSYGVVTQVVDQDGATATTTEQISVG
PPTTGGTAVTRVAGADRYRTAIAISSKLAAGSAPAVVLATGEAFPDALAGVSLAKQVGGP
LLLTPSAAPDAAVTAEIKRVLKPGGTVYVLGGTNAVSPAVVSALGAVTVTRIGGADRYET
ALRIADRLGDPSNVVLATGADYADALAAGPYASDVFAVDASHPAAILLTATTQMSPAVQA
YVKKAHAVAAVGGQAVTAANNAHISLAPHASFSGYDRYFTAAMVAAAFQGEHTAGVATGE
NYADALTGAASLAQAGGPLVLTQTHLLTPAAWHALQGIEASVGATGTVEVFGGPAAVSTA
TVAQIVEAVHGHMA
Download sequence
Identical sequences C7Q206
WP_015797267.1.73754 479433.Caci_8728 gi|256397820|ref|YP_003119384.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]