SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|383754891|ref|YP_005433794.1| from Selenomonas ruminantium subsp. lactilytica TAM6421

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|383754891|ref|YP_005433794.1|
Domain Number 1 Region: 1-435
Classification Level Classification E-value
Superfamily Phase 1 flagellin 3.66e-67
Family Phase 1 flagellin 0.00049
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|383754891|ref|YP_005433794.1|
Sequence length 436
Comment putative flagellin [Selenomonas ruminantium subsp. lactilytica TAM6421]
Sequence
MMVSHYGMSTKIVNIMGAHASKLAKHMQHLSTGMRVSCVADDPSGWAIGQRMDVRIRGID
QACRNAQFSQSMLKVAEGGINSTIDLLRNLKEKAIEAASDTCTDSDRRTIQKLFDQYGDQ
IDDNANITFNGKILLDGSLNSPALDTAQVMTNQSLSTDTTAGSKLTDLKRRDGDSLNILA
TDTINLSYVKNGHTYYGSYSAGTTTLADMLTEFNNIDGAIFDAGALQDTSLIGTDSAGNT
VYTADNENAISFAAAATGLDGAISGLTISVTDKDGQIKKSATTALNDFHESIEPRDKQSS
GLFYTATSADANRGMTSAIGDMRGYSLGVVSKEGHGLDVSTQKSANAALSVLDRALERAL
AQQTTIGAMSMRLDYTISNLTTESENLTAAMSTILDADMAKEMTEFTKENILLQAAQAML
AQNNHQAGWFLSLLQS
Download sequence
Identical sequences I0GSN4
WP_014425201.1.93961 gi|383754891|ref|YP_005433794.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]