SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|383755002|ref|YP_005433905.1| from Selenomonas ruminantium subsp. lactilytica TAM6421

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|383755002|ref|YP_005433905.1|
Domain Number 1 Region: 16-239
Classification Level Classification E-value
Superfamily Adenine nucleotide alpha hydrolases-like 1.26e-54
Family PP-loop ATPase 0.0000497
Further Details:      
 
Domain Number 2 Region: 358-447
Classification Level Classification E-value
Superfamily PheT/TilS domain 1.36e-17
Family tRNA-Ile-lysidine synthetase, TilS, C-terminal domain 0.011
Further Details:      
 
Domain Number 3 Region: 218-326
Classification Level Classification E-value
Superfamily MesJ substrate recognition domain-like 0.00000000000314
Family MesJ substrate recognition domain-like 0.0066
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|383755002|ref|YP_005433905.1|
Sequence length 466
Comment putative tRNA(Ile)-lysidine synthase [Selenomonas ruminantium subsp. lactilytica TAM6421]
Sequence
MVWHKLEALCKGCFCSLLPKGARILAACSGGADSMALLDILWRLAPRFQWQVAVAHYEHG
IRGEASLADARFVADFCQKRRIPCFVEHGDVPGAAAENSHTLEQAARDLRYAFLQRICRE
KGFGYIATAHHADDQAETVLMRILRGTGVKGLGAMRPYSGDEILLVRPLLGASKAEIMAY
CEQAGLAFREDATNSVADCTRNRLRLELLPQLQRDYNPEIRRSLCQLAEVAAETSDFLQS
EVNRYWQDAAYVRQGDWALSQKTVAGLHPALQRGLIRRLWAEVTGSALDLSYVQTERLRS
LLLTGQTSSQQELSHHYVARLAYGYLQIDKSKPDRQADQSKSDQSEVAVPGMTSWGEWIL
QGEWRKPDGHKTLPHELYLDPANFSEPLVLRTRRPGDFMQLPGGRKKLKKLLIDDKIPQE
ERDRLLLLAAGSEIIWMIGRRRSARCLQGVADYHKILYLRIEKRGN
Download sequence
Identical sequences I0GSZ5
WP_014425309.1.93961 gi|383755002|ref|YP_005433905.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]