SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|383755144|ref|YP_005434047.1| from Selenomonas ruminantium subsp. lactilytica TAM6421

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|383755144|ref|YP_005434047.1|
Domain Number 1 Region: 145-227
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 0.00000101
Family Cold shock DNA-binding domain-like 0.029
Further Details:      
 
Weak hits

Sequence:  gi|383755144|ref|YP_005434047.1|
Domain Number - Region: 76-172
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 0.00185
Family Cold shock DNA-binding domain-like 0.033
Further Details:      
 
Domain Number - Region: 230-285
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 0.0143
Family Z-DNA binding domain 0.083
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|383755144|ref|YP_005434047.1|
Sequence length 290
Comment putative nucleic acid binding protein [Selenomonas ruminantium subsp. lactilytica TAM6421]
Sequence
MEEQSKRKYGPSSVATLKVVRESELGAFLDAETGNTNDDILLHKNQQTSPVKIGDEVEVF
LYLDPNRKLTASMRVPKMREGQIARLKVINVSRDGAFVDVGAERGIFMPYAGMRGRPQIG
EVVWAKLYTDKSGRLAVTMEVEDEMRRASQPAKGVKKGQLVKGAIYNYTDAGAFLFSEER
YIVFIANKEMDERNRPRVGQVVTARVTYIRDDGRLNASLKESKEKALITDGEKIMELLRN
RDGKMPYSDESSPEVIRDKFGISKAAFKRALGHLIKEQKVFEEDGWTYLK
Download sequence
Identical sequences I0GTD7
WP_014425448.1.93961 gi|383755144|ref|YP_005434047.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]