SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|383755297|ref|YP_005434200.1| from Selenomonas ruminantium subsp. lactilytica TAM6421

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|383755297|ref|YP_005434200.1|
Domain Number 1 Region: 1-133
Classification Level Classification E-value
Superfamily FlgN-like 0.000000000000458
Family FlgN-like 0.021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|383755297|ref|YP_005434200.1|
Sequence length 160
Comment putative FlgN family protein [Selenomonas ruminantium subsp. lactilytica TAM6421]
Sequence
MWQDFANILNELNKDYKALIEIGKKKRTALILVDMKTVEALLPEEEKTTSHIAQLEKKRQ
AILLKLAATNEKLGPDSKMEDIMGLIPAGKLRSVVQNLYRMLQATVKEAKELSEGNALLI
RAAMEAAAFHLNRLGGAQVEPAYGKGGEATTHHKNFEFNA
Download sequence
Identical sequences I0GTU0
gi|383755297|ref|YP_005434200.1| WP_014425598.1.93961

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]