SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|383755344|ref|YP_005434247.1| from Selenomonas ruminantium subsp. lactilytica TAM6421

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|383755344|ref|YP_005434247.1|
Domain Number 1 Region: 9-90,216-431
Classification Level Classification E-value
Superfamily Zn-dependent exopeptidases 6.85e-85
Family Bacterial dinuclear zinc exopeptidases 0.002
Further Details:      
 
Domain Number 2 Region: 91-215
Classification Level Classification E-value
Superfamily Aminopeptidase/glucanase lid domain 2.38e-31
Family Aminopeptidase/glucanase lid domain 0.0033
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|383755344|ref|YP_005434247.1|
Sequence length 432
Comment putative M18 family aminopeptidase [Selenomonas ruminantium subsp. lactilytica TAM6421]
Sequence
MKKAVMDMNKEVQDLLDFIKAAPTPYHTVQAAAEKLAGAGFVELSLTEKWQLQSGGRYFV
KVFDSTLLAFAVGQEAGPLRLAAAHTDFPCFRLKPQAGMVKEGYGVLNVEKYGGLMLRTW
LDRPLALAGKVALRGADPFQPEVRLVDFNRPLLTIPSLAIHMDREVNENGKLNAQKDMLP
LASMGGEELKTEFFMEWLAGEMGVDPSTILSYELSVYPYEEGSVCGLQEEFVSSPRLDNL
TSVVACLEGIMAADSHCAGLRMAALFDNEEVGSRTKQGAGSLVLLQTIERIYLVLGKAKE
DMLADIAGGFMLSVDVAHALHPNFADKCDPSHKPVLGGGVVLKQAASQSYAGDTEAVAIV
RGLCEAKDIKWQHFVNRSDSRGGSTLGSIASALVPMRTMDIGVPLLAMHSARETMHGEDQ
RALDKLLKVFWA
Download sequence
Identical sequences I0GTY7
gi|383755344|ref|YP_005434247.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]