SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|383755432|ref|YP_005434335.1| from Selenomonas ruminantium subsp. lactilytica TAM6421

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|383755432|ref|YP_005434335.1|
Domain Number 1 Region: 40-152
Classification Level Classification E-value
Superfamily OmpH-like 6.8e-21
Family OmpH-like 0.005
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|383755432|ref|YP_005434335.1|
Sequence length 154
Comment putative OmpH family protein [Selenomonas ruminantium subsp. lactilytica TAM6421]
Sequence
MVKLQKKQVKIVSILIALAFVGSVVAMALTQFGPNMASAASSNVGVVDYSQIMSQHPKVQ
DASKEMQEAVTAAQKEFETKSANMNDNEKRDYYTQTQQRLQQKNQELMEPITKSVEESVK
KVAEQKGLSVVLDKGAVVYGGVDITQDVLKQVSK
Download sequence
Identical sequences I0GU75
gi|383755432|ref|YP_005434335.1| WP_014425731.1.93961

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]