SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|383753979|ref|YP_005432882.1| from Selenomonas ruminantium subsp. lactilytica TAM6421

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|383753979|ref|YP_005432882.1|
Domain Number 1 Region: 3-321
Classification Level Classification E-value
Superfamily FMN-binding split barrel 2.63e-111
Family UbiD middle domain-like 0.000000214
Further Details:      
 
Domain Number 2 Region: 322-485
Classification Level Classification E-value
Superfamily UbiD C-terminal domain-like 4.97e-60
Family UbiD C-terminal domain-like 0.0000177
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|383753979|ref|YP_005432882.1|
Sequence length 486
Comment putative 3-octaprenyl-4-hydroxybenzoate carboxy-lyase [Selenomonas ruminantium subsp. lactilytica TAM6421]
Sequence
MAYKDLREFMADLESKGLLKRIKTEVDPELEITEITDRVSKMEGDKNVALLFENVKGSKM
PVLMNAFGSYERMAMALGVEKLDDVGDELREMLKLPYVSLQNKMSVVTMIPMIKRAINFP
KYVKNAPCQEVVETENPNLDEIPILKCWPDDGGPFVTLPLVFTKNPKTGKRNVGMYRLQK
YDSRTTGMHWHIHKNGAENFRDMKAQGGDRIEAAVAIGTDPVITYAATAPLPRDIDEMVF
AGFLRHKSVEMVKCKTVDIEVPATAEIILEGYVLTDEKRREGPFGDHTGYYSLADDYPVF
HITAITHRKDPIYFSTVVGKPPMEDCYLAKATERIFLPLLQQMQPEIIDINMPLEGVFHD
CCIVSIKKQYPMQARKVMHALWGMGQMMNVKMIIVVDAHVNVQDLKEVWWRVYNNIDAKH
DLEIVEGPLDVLDHSSPMAKWGSKMGIDATKTWPEEGHTREWPEEINMSEEIKARVDAKW
KELGLD
Download sequence
Identical sequences I0GQ22
gi|383753979|ref|YP_005432882.1| WP_014424296.1.93961

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]