SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|240138777|ref|YP_002963249.1| from Methylobacterium extorquens AM1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|240138777|ref|YP_002963249.1|
Domain Number 1 Region: 60-154
Classification Level Classification E-value
Superfamily Ribosomal protein L6 9.16e-37
Family Ribosomal protein L6 0.0000307
Further Details:      
 
Domain Number 2 Region: 2-59
Classification Level Classification E-value
Superfamily Ribosomal protein L6 0.000000000000678
Family Ribosomal protein L6 0.0015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|240138777|ref|YP_002963249.1|
Sequence length 154
Comment 50S ribosomal protein L6 [Methylobacterium extorquens AM1]
Sequence
MKMKGSKGELQFVVPSQVVVEFKDGAVSVQPKDQSKQARSLWGTSRAQVANLVEGVSKGF
EKKLEITGVGYRAAMAGKALKLSLGYSHDIEYEIPAGITIVTPKPTEIVVTGIDRQRVGQ
VAAEIREYRGPEPYKGKGVKYAGEFIFRKEGKKK
Download sequence
Identical sequences C5APT7
272630.MexAM1_META1p2177 gi|240138777|ref|YP_002963249.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]