SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|352681690|ref|YP_004892214.1| from Thermoproteus tenax Kra 1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|352681690|ref|YP_004892214.1|
Domain Number 1 Region: 11-400
Classification Level Classification E-value
Superfamily L-aspartase-like 5.65e-86
Family L-aspartase/fumarase 0.00000544
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|352681690|ref|YP_004892214.1|
Sequence length 425
Comment argininosuccinate lyase [Thermoproteus tenax Kra 1]
Sequence
MALYRRWIGGSSDLVSQYTSSIDDDREIADEVVKVMRAHVAHLSERGLIPRDAADSILRA
LDELRPPDLLKPGYEDVHEALEDYLMKRVGPAGGWVGLGRSRNDHVAAAIRLRLIRHIDA
LTAIAERAACAIAEKALRYADCVMPSFTHFQPAQPITLGHYLLALCELLSDFTAALNAAR
QIADKSPLGSGPSGGTSAPVDRERLAQLAGFGRIAGNTLYASSSRFFASLAASAVASALA
EISRFVDDLIAWSSPLVGYVRAPAEHVSTSSIMPHKRNPVTLEILRARISEALADALALM
MVQEKIGYGYSLDLQEATRHLWRVFKTAEEGLEVLSDFISKMDFDCQRSYRDAAAFPTTS
SDLAERIALAGTPFREAYFQVAQAVKEGNAQLPDPRDAVRRPVSGGPDPGEVAKSAKEIL
AKCGR
Download sequence
Identical sequences G4RNJ0
gi|352681690|ref|YP_004892214.1| WP_014126391.1.28421

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]