SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|352682040|ref|YP_004892564.1| from Thermoproteus tenax Kra 1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|352682040|ref|YP_004892564.1|
Domain Number 1 Region: 14-44,161-329
Classification Level Classification E-value
Superfamily Zn-dependent exopeptidases 0.00000000000000419
Family Bacterial dinuclear zinc exopeptidases 0.032
Further Details:      
 
Domain Number 2 Region: 46-135
Classification Level Classification E-value
Superfamily PA domain 0.0000183
Family PA domain 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|352682040|ref|YP_004892564.1|
Sequence length 438
Comment putative aminopeptidase [Thermoproteus tenax Kra 1]
Sequence
MGELANKCSEYRDLVAGSPEERAFLDYISSILDLPFIWMQLTPVEVLYWRDGGSWIEVGE
MRLEALALPYSKGGVLEGRLVDINGDVEGNIAVAPFPSDLNDAKYVVIDAARRGAIAVVL
YGEPLRRIVVTDELGFKYDAAPPPIPAISAPTSIAKMTGSRARLVVNASSNVTYSYNIIA
MNSFEDTPMISAHYDHWLYGASDNCGGVEAAVTAFLDLVAEDYPVALGLFTAEEGVAPHV
PSLYWAWGSLIYFSKWRPRHLVNLDVVGTGSPKAYVMPYMREVVSGLLPVEWPRPDFDSL
NYELRGMPSVTISALDDVWPVYHSPLDNRVDDAMITLTVDIAKRIVKTEPRRPEVDLSHY
GIPVRADPYDAWSLIYNYLVIFKNNNHSDIVYVNIFDFLKRNAKDYIRIDVLGGPTLCVN
NCDKAFDYYRELAYAALI
Download sequence
Identical sequences G4RPJ0
WP_014126741.1.28421 gi|352682040|ref|YP_004892564.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]