SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|352682484|ref|YP_004893008.1| from Thermoproteus tenax Kra 1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|352682484|ref|YP_004893008.1|
Domain Number 1 Region: 5-416
Classification Level Classification E-value
Superfamily L-aspartase-like 5.6e-100
Family L-aspartase/fumarase 0.0000000525
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|352682484|ref|YP_004893008.1|
Sequence length 445
Comment fumarate hydratase class II (fumarase) [Thermoproteus tenax Kra 1]
Sequence
MDFEERARRVYLDTGTKFQRPIIWSMGLIKYAAAYANAELGLLPRRLAAAIMGASLEVME
GVHDAEVYVDVFQTGSGTGLNMNINDVIARRASEIAGSRVHPNDHVNMGQSSNDVVPSAV
RIAAIKTAEDELMPALSALIGRLSEKSAEFSKVVKPGRTHLRDALPVTLGQELGAYADAL
AHGCRELRDVLAYVGEIPLGGTAVGTGFGTHPRFRRLAIDAINKTSGLRLSEGNTFRGMR
LLTDVLYLSAALRNIAVELMRLAQDVRLMFSGPTAGLAEIDLPSQAEVPGSSMMPGKINP
VTAEAVMLAAAQIVGLDHANQAAAGLGEFELAMGIPLIGYNVVAQINLLSEASGKLSELV
IADMKPRRDRLRDLAERSPALATALAPALGYEGVSQVVRKISEGKSIRVALEEVGRPDLA
QEIPDVDNMAQAPEAERRIDCDSYK
Download sequence
Identical sequences G4RK35 Q704C7
gi|352682484|ref|YP_004893008.1| WP_014127185.1.28421

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]