SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|352682994|ref|YP_004893518.1| from Thermoproteus tenax Kra 1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|352682994|ref|YP_004893518.1|
Domain Number 1 Region: 4-156
Classification Level Classification E-value
Superfamily Resolvase-like 2.49e-29
Family gamma,delta resolvase, catalytic domain 0.0018
Further Details:      
 
Weak hits

Sequence:  gi|352682994|ref|YP_004893518.1|
Domain Number - Region: 159-205
Classification Level Classification E-value
Superfamily Homeodomain-like 0.0161
Family Paired domain 0.096
Further Details:      
 
Domain Number - Region: 209-246
Classification Level Classification E-value
Superfamily YfgJ-like 0.0405
Family YfgJ-like 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|352682994|ref|YP_004893518.1|
Sequence length 253
Comment putative site-specific recombinase [Thermoproteus tenax Kra 1]
Sequence
MIPAIAYIRVSTEEQDPENQREYLEKWAPAHGLAIIKYYVDVGVSGAIEPWERPAFKRLM
EEVPQMSPKPKVLLVYEVSRLVRSFQELFKLLDVVEEKLGLVVVSASEREQALQTVDGMY
RQFLRAVLAFVAAMEREFIRQRTKAALVRAKAAGKITNVAERVSPEIAMKIVEMRRAGAS
LREIGRAFGLSTYEVRRILSAAGEYRPDETTCPRCFSKMRVAERSAKIADGLYKVVERLY
CPNCGYEEVVERA
Download sequence
Identical sequences G4RLJ5
WP_014127694.1.28421 gi|352682994|ref|YP_004893518.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]