SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|352683086|ref|YP_004893610.1| from Thermoproteus tenax Kra 1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|352683086|ref|YP_004893610.1|
Domain Number 1 Region: 167-284
Classification Level Classification E-value
Superfamily DNA primase core 0.000000000314
Family DNA primase DnaG catalytic core 0.02
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|352683086|ref|YP_004893610.1|
Sequence length 406
Comment putative DNA primase DnaG [Thermoproteus tenax Kra 1]
Sequence
MGALTIASKYMIVAQIEVNGTVDKSDIIGALFSQTEGLLRKDMDLRELRIMGRIGRIDID
IISKDGKTKAKINIPSNLDRYETALVAALIESVERVGPYPATVKILEIRDLREEKRNKIV
ERAKELIKLIEEEILPDTKEILERLKEDVAKAEIVEYGPEKLPAGPDVDKSDSIIIVEGR
ADVVNLVKHGYRNVIAIEGISQGIPQTIVELSKRKTVTAFVDGDKGGELVLRDLLKVAHV
DYIARAPPGKEVEQLTAKEIARALRNKLTVEEYMAQQKSQEQQAPAEPAAAPAVAVQQQV
SSVSEIPDSLKTKVDELLGTLETEIYDDKWSLIKRVAVRELPDFLTSTETQLYAILMDGI
VTQRIVDLATKRGVRYIIAARIGPITKVPEEMRILSFDELKGGAKA
Download sequence
Identical sequences G4RLT7
gi|352683086|ref|YP_004893610.1| WP_014127785.1.28421

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]