SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|222824192|ref|YP_002575766.1| from Campylobacter lari RM2100

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|222824192|ref|YP_002575766.1|
Domain Number 1 Region: 44-193
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 3.67e-41
Family Myf domain 0.0018
Further Details:      
 
Domain Number 2 Region: 460-673
Classification Level Classification E-value
Superfamily Class II aaRS and biotin synthetases 1.34e-29
Family Class II aminoacyl-tRNA synthetase (aaRS)-like, catalytic domain 0.0012
Further Details:      
 
Domain Number 3 Region: 680-776
Classification Level Classification E-value
Superfamily Anticodon-binding domain of PheRS 2.09e-23
Family Anticodon-binding domain of PheRS 0.0019
Further Details:      
 
Domain Number 4 Region: 403-468
Classification Level Classification E-value
Superfamily Putative DNA-binding domain 0.0000000000000247
Family Domains B1 and B5 of PheRS-beta, PheT 0.0051
Further Details:      
 
Domain Number 5 Region: 220-372
Classification Level Classification E-value
Superfamily PheT/TilS domain 0.00000000000217
Family B3/B4 domain of PheRS, PheT 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|222824192|ref|YP_002575766.1|
Sequence length 776
Comment phenylalanyl-tRNA synthetase subunit beta [Campylobacter lari RM2100]
Sequence
MIISRNWLNEWIDLSEISTQAIVNTLNSIGLEVDSFKSVKAPQKVVIGKVLEKVKHENSD
KLNICKVDIGSEILQIVCGAKNVDKDQFVAVSLVGAVLPNGLEIKPAKLRGVESMGMICS
SSELGFGKSNEGIMVLDESMGELVLGKVLNDYELFNDELIEIELTPNRGDCLSLYGVARD
LSAALDLNLKELNPLKESENSVGIGRILSVKNQSDVEGFFAYRALEIKEEFKLNITIQIR
LALIEAYKNNNIENLLTYATHASGVIFCAYDFHKLCQDCQIDEKIVLEIKTQEHGEYGVY
YKDELIALAGIEQEDKFKINDESKIIIIEASYTHPQTIANAIAFYKKKNDTIYRSLRGSE
PKLSLGMEYLFNECLKISAMSVFSGSQQVFKENEANIIGIFGAEIDKIIGMPIDKNNLVK
ILKKLGFEISVVNDEQFNIKIPLHRSDIANIADISEEIVRIIGIDNIPSKALEFKEKNRL
NKVYFDYQELKNLRLKASSNGYFESVHYVLDNEEQLSQLGFKCIKNKLINPITNELNTLR
STLINHLLNAASFNLRNSKKKIKLFECGSVFDEFSNEHAKFAMIFSGYKEEAKITNKAKP
VLVDFYTFLAELKSIIGEFSLQKSEYAFLSPYEQANVYKNGKRIGFIGRVHLGIENKRDL
AKTYICELDLEGLKQDFKTAKAYSKFPSISRDLSIVIPKGFEYEKIKHTIAKLDIERLES
FRVVDLYTDENLGDFYSLTINLVFRDFEKTLEDNIILEYIDKIIKVLDDEYGLKLR
Download sequence
Identical sequences B9KD76
gi|222824192|ref|YP_002575766.1| 306263.Cla_1193 WP_012661898.1.78799

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]