SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for jgi|Cocca1|108572|e_gw1.259.28.1 from Cochliobolus carbonum 26-R-13 v1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Cocca1|108572|e_gw1.259.28.1
Domain Number 1 Region: 82-299
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 1.68e-43
Family C-terminal domain of adrenodoxin reductase-like 0.00000861
Further Details:      
 
Domain Number 2 Region: 9-138,305-377
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 0.00000000112
Family C-terminal domain of adrenodoxin reductase-like 0.00086
Further Details:      
 
Weak hits

Sequence:  jgi|Cocca1|108572|e_gw1.259.28.1
Domain Number - Region: 341-448
Classification Level Classification E-value
Superfamily Nucleotide-binding domain 0.00188
Family N-terminal domain of adrenodoxin reductase-like 0.00017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) jgi|Cocca1|108572|e_gw1.259.28.1
Sequence length 453
Sequence
MNKNQDAVIDMYEQLPVPYGLVRYGVAPDHPEVKNCQDTFEEVARSPRFNYIGNVKVGYD
VQLADMKPHYDAILFSYGATEDRQLGIPGEHLSGVYSARSFVGWYNGLPQFQHLEPNLDA
GEQAVVIGQGNVALDVARILLSPVDALRNTDIADQAIQALSESKVRSVRVVGRRGPIQAA
FTVKEARELMQIPSVAFEPIDRSLYPADIKKLPRVQKRIAEVLLKGSATPAQQATRSWAL
DFMQAPKAMHEVDGHLSSITFTKQQFVPDGDPFDQRTRVVPTKDETKIEASLAFRSVGYK
SAAIPGLSDIGVPFDDKLGIIPNDMHGRVITPSAGPGNLTAGHVSGLYCAGWVKRGPTGV
IASTMQDAFSSADIIAQDWEAGVPFLNDTNGENKGTRLGWEALREAVESKGARPLSWTDW
KKIDDAERENGKARGKQREKFQSVEEMLSVLDA
Download sequence
Identical sequences W6XMX8
jgi|Cocca1|108572|e_gw1.259.28.1 XP_007717039.1.9443

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]