SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for jgi|Cocca1|103156|e_gw1.153.77.1 from Cochliobolus carbonum 26-R-13 v1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Cocca1|103156|e_gw1.153.77.1
Domain Number 1 Region: 404-706,752-839
Classification Level Classification E-value
Superfamily Metallo-dependent hydrolases 5.01e-192
Family alpha-subunit of urease, catalytic domain 0.000000000533
Further Details:      
 
Domain Number 2 Region: 275-451
Classification Level Classification E-value
Superfamily Composite domain of metallo-dependent hydrolases 1.02e-66
Family alpha-Subunit of urease 0.0000151
Further Details:      
 
Domain Number 3 Region: 138-267
Classification Level Classification E-value
Superfamily Urease, beta-subunit 2.62e-45
Family Urease, beta-subunit 0.0000672
Further Details:      
 
Domain Number 4 Region: 1-105
Classification Level Classification E-value
Superfamily Urease, gamma-subunit 9.16e-39
Family Urease, gamma-subunit 0.00013
Further Details:      
 
Weak hits

Sequence:  jgi|Cocca1|103156|e_gw1.153.77.1
Domain Number - Region: 701-752
Classification Level Classification E-value
Superfamily Composite domain of metallo-dependent hydrolases 0.0104
Family alpha-Subunit of urease 0.0023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) jgi|Cocca1|103156|e_gw1.153.77.1
Sequence length 839
Sequence
MQLCPKELDKLVISQLGLLAQRRLARGVKLNHAEAAALIANNLHELIRDGNHTVADLMSI
GKTMLGRRHVQPAVVSSLVELMVEGTFPTGTYLVTVHHPISTEDGDLEKALYGSFLPIPS
NELFPLPDPSVYDDTKQPGAIVAVKGESGLIKLNEGRKRIKLKVKSVGDRPIQVGSHYHF
IETNPQLQFDRVRAHGYRLDIPAGTSVRFEPGDTRTVTLVQIGGNQIIKGGNQIASGFIG
DLSVANTIVEKLQAGGFLHEPEPHGDAAHIDICTMERQVYISMFGPTTGDLVRLGATDLW
IKVEKDMTVYGDECAFGGGKTLREGMGQAGGRSDKESLDTVITNALIVDWSGIYKADIGI
KDGMIVGIGKAGNPDVMDGVDPRLVVGACTDVIAGEHKIVTAGGIDTHIHLICPQQAEEA
IASGITTMLGGGTGPSTGSNATTCTPGKTHIKQMLQAIDELPLNYGITGKGNDSELRPLQ
QQAEAGVCGLKLHEDWGSTPAAIDACLQVCDEYDIQTLIHTDTLNESGFVESTIAAIKGR
TIHTYHTEGAGGGHAPDIISVVEHDNVLPSSTNPTRPYTRNTLDEHLDMLMVCHHLSRNI
PEDVAFAESRIRAETIAAEDVLHDLGAISMMSSDSQAMGRCGEVILRTWNTAHKNKVQRG
TLKEDEGTDADNFRVKRYISKYTVNPAIAQGMGHLIGSVEVGKLADLVLWTPNNFGVKPN
LIVKSGFCSYAVMGDPNGSIPMVEPRIMRPMFAPLVPASSITFVSQASIASGVVHSYGLR
KRVEAVKNCRNIGKRDMKFNDTRPKMKVDPESYTVEADGMVCVAEPAETLPLTQGYFVY
Download sequence
Identical sequences W6YHC5
jgi|Cocca1|103156|e_gw1.153.77.1 XP_007714985.1.9443

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]