SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|254556523|ref|YP_003062940.1| from Lactobacillus plantarum JDM1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|254556523|ref|YP_003062940.1|
Domain Number 1 Region: 4-203
Classification Level Classification E-value
Superfamily Formyltransferase 1.57e-64
Family Formyltransferase 0.00000451
Further Details:      
 
Domain Number 2 Region: 205-308
Classification Level Classification E-value
Superfamily FMT C-terminal domain-like 3.34e-24
Family Post formyltransferase domain 0.00092
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|254556523|ref|YP_003062940.1|
Sequence length 317
Comment methionyl-tRNA formyltransferase [Lactobacillus plantarum JDM1]
Sequence
MTSIVFMGTPAFAAPILESLIKEQYQVLGVVTQPDRKVGRKHVLTASPVKEVAVAHDIPV
FQPEKISGSPEMQQIIDLQPDLIVTAAFGQFLPTKLLKAAKIGAVNVHGSLLPKYRGGAP
VQYSIINGESETGITIIYMVKKMDAGDMLAQRAIPIEKNDDTGTMFDKLSLVGRDLLLET
LPKLIAGEITAVPQDESQVTFAPNIQPEQEVLDFFTKTAVEIDNQVRGMRPAPIAYAVLD
GKRTKFWDVTPLADEVVTQAPGQVVRKTKHELVIAAADHTAIAINQLQPAGKPKMTITDY
LNGAADKFATGEQVINK
Download sequence
Identical sequences A0A1E3KRR5 A0A2J6U4F4 Q88WL3
gi|254556523|ref|YP_003062940.1| WP_011101475.1.100429 WP_011101475.1.1220 WP_011101475.1.12283 WP_011101475.1.12549 WP_011101475.1.17136 WP_011101475.1.19463 WP_011101475.1.20190 WP_011101475.1.25870 WP_011101475.1.27617 WP_011101475.1.29036 WP_011101475.1.30329 WP_011101475.1.31165 WP_011101475.1.33465 WP_011101475.1.34840 WP_011101475.1.44182 WP_011101475.1.49466 WP_011101475.1.56089 WP_011101475.1.57 WP_011101475.1.59418 WP_011101475.1.6273 WP_011101475.1.64570 WP_011101475.1.73499 WP_011101475.1.76771 WP_011101475.1.7682 WP_011101475.1.76822 WP_011101475.1.83620 WP_011101475.1.85827 WP_011101475.1.92717 WP_011101475.1.9834 WP_011101475.1.99274 YP_004889443.1.96219 gi|380032452|ref|YP_004889443.1| 220668.lp_1616 644042.JDM1_1356

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]