SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|254557813|ref|YP_003064230.1| from Lactobacillus plantarum JDM1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|254557813|ref|YP_003064230.1|
Domain Number 1 Region: 3-194
Classification Level Classification E-value
Superfamily ITPase-like 1.15e-44
Family ITPase (Ham1) 0.00016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|254557813|ref|YP_003064230.1|
Sequence length 195
Comment xanthosine triphosphate pyrophosphatase [Lactobacillus plantarum JDM1]
Sequence
MTTTWLIASNNAGKSRDLIACLAYYGLTARQYLTVAPRLEFPVETTTSYVDNAVAKARFG
AQQLGVTVIADDSGLEISALPDLLGVTTARDLGVAVSGFDRNQEILTALRDIPDNERQAL
MRATLAAAWPDGRTLAVQASITGYIASYQFGRYSGGFDRIFWLPRYGRTFAELPATWRIP
LTHRGRAALKLITKL
Download sequence
Identical sequences A0A2D2ADA2
WP_015826056.1.1220 WP_015826056.1.12283 WP_015826056.1.30329 WP_015826056.1.59418 WP_015826056.1.76822 WP_015826056.1.92717 WP_015826056.1.9834 gi|254557813|ref|YP_003064230.1| 644042.JDM1_2647

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]