SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|221633135|ref|YP_002522360.1| from Thermomicrobium roseum DSM 5159

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|221633135|ref|YP_002522360.1|
Domain Number 1 Region: 6-142
Classification Level Classification E-value
Superfamily YaeB-like 1.96e-38
Family YaeB-like 0.00037
Further Details:      
 
Domain Number 2 Region: 157-242
Classification Level Classification E-value
Superfamily FwdE-like 0.0000000000144
Family FwdE-like 0.0066
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|221633135|ref|YP_002522360.1|
Sequence length 271
Comment hypothetical protein trd_1151 [Thermomicrobium roseum DSM 5159]
Sequence
MNDEAFRLVPIGVVHSPVADRRLMPPNGVEAEIEIFPDFADGLLRIEENSHLWVLGWFVD
ADRERLELVRPEYDPARRRRGVFGLRSVARPNPIALTATRLLAVEGLRLRVAPLDFIDGT
PIVDLKRYSPSWDCIFSARSSRDRYLIDWDSPERLAEYEREATNFHGELCGWVIIGARII
QHLGLLWKVHPKDEDLRVTVSDDPELTHLADALQALTAATLGNGRLRVTSERKVSFTWRE
RRWTVAPRPLPDLPLEAFRSLAIERLIDEYS
Download sequence
Identical sequences B9L0T0
gi|221633135|ref|YP_002522360.1| 309801.trd_1151 WP_015922104.1.69661

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]