SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|221635450|ref|YP_002523326.1| from Thermomicrobium roseum DSM 5159

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|221635450|ref|YP_002523326.1|
Domain Number 1 Region: 87-203
Classification Level Classification E-value
Superfamily Flagellar hook protein flgE 4.84e-21
Family Flagellar hook protein flgE 0.0038
Further Details:      
 
Weak hits

Sequence:  gi|221635450|ref|YP_002523326.1|
Domain Number - Region: 195-234
Classification Level Classification E-value
Superfamily Phase 1 flagellin 0.0889
Family Phase 1 flagellin 0.062
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|221635450|ref|YP_002523326.1|
Sequence length 248
Comment flagellar basal-body rod protein FlgF (Putative proximal rod protein) [Thermomicrobium roseum DSM 5159]
Sequence
MIRTIYQAAAGMMAQFARQLTLATNLANIETPGYRQQESTIRDFQQMFLLRLGRGEASPI
GTLSTAVRWDKPLVDLRQGSLIETGRPLDLALAGRAFFAIQTPDGVEYTRDGRFQLDAQR
RLVTADGHPVLGEQGPLVLPAGDIWVEPDGTILVGEQVVGRLLLVEFPPDAQFEPVAGNR
YRTDATGAPSETTGVSQGFLEASNVDLTQTLTDMLAATRSYQLAARSLQLADETLRLAVN
SVGRVNQG
Download sequence
Identical sequences B9L5B7
gi|221635450|ref|YP_002523326.1| WP_012642403.1.69661 309801.trd_A0044 gi|221635450|ref|YP_002523326.1|NC_011961

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]