SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|221635451|ref|YP_002523327.1| from Thermomicrobium roseum DSM 5159

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|221635451|ref|YP_002523327.1|
Domain Number 1 Region: 88-219
Classification Level Classification E-value
Superfamily Flagellar hook protein flgE 1.57e-19
Family Flagellar hook protein flgE 0.0021
Further Details:      
 
Weak hits

Sequence:  gi|221635451|ref|YP_002523327.1|
Domain Number - Region: 217-249
Classification Level Classification E-value
Superfamily Phase 1 flagellin 0.0288
Family Phase 1 flagellin 0.055
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|221635451|ref|YP_002523327.1|
Sequence length 259
Comment flagellar basal-body rod protein FlgG [Thermomicrobium roseum DSM 5159]
Sequence
MEALYFPAVSGVRAQQVRLDTIAHNLANLETDGFKAARADFTAVPPQEYRVARAGEAPLG
PVPIGSGVELSATTRQFTLGPVEVTGDPFDLALAGPDTFVATELPDGTTAFRRSGRLSID
ATGRLVFEDGSLLQPPLVLPAGAQLDRIAPDGTVFVRAAGSGDAQPIGRLELVRFPNPQG
LLAAGQGRWIATEAAGQPETGAPGEGNWPPVLSGVREHSNVDLVDQMTQLIMAQRAYTAN
LRSLQTIDELIEIATRLRQ
Download sequence
Identical sequences B9L5B8
gi|221635451|ref|YP_002523327.1|NC_011961 309801.trd_A0045 gi|221635451|ref|YP_002523327.1| WP_012643216.1.69661

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]