SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|221635455|ref|YP_002523331.1| from Thermomicrobium roseum DSM 5159

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|221635455|ref|YP_002523331.1|
Domain Number 1 Region: 1-291
Classification Level Classification E-value
Superfamily Phase 1 flagellin 5.62e-62
Family Phase 1 flagellin 0.0014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|221635455|ref|YP_002523331.1|
Sequence length 291
Comment flagellar hook-associated protein 3 [Thermomicrobium roseum DSM 5159]
Sequence
MRVTHGMLVDTLLKNLSGNLARMERVYQQITSARRISRPSDDPVGTATVLRLGSAAQEIE
QYLANVEQARTWLDLTDQALTTIGQSLQRARELVVQAANDTLSADDRQAIWQELTALQEQ
IATTGNYAHAGRYLFAGSLTQTEPFDLSTDPPTYRGNSDQLQRLIDRGVTIDINVTGDTA
IVPVLTAIKQARDAVAANDPVAIRSQLAAIDAAHTQLLAAQASVGARVNRLEAQRDRLLD
AHTSTLRLASEAGDTDMAEAITRFSKEELTYRAALQAGARAIQPTLLDYLR
Download sequence
Identical sequences B9L5C2
gi|221635455|ref|YP_002523331.1| 309801.trd_A0049 gi|221635455|ref|YP_002523331.1|NC_011961 WP_012642392.1.69661

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]