SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|221635518|ref|YP_002523394.1| from Thermomicrobium roseum DSM 5159

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|221635518|ref|YP_002523394.1|
Domain Number 1 Region: 11-133
Classification Level Classification E-value
Superfamily AF1862-like 1.29e-30
Family Cas Cmr5-like 0.00099
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|221635518|ref|YP_002523394.1|
Sequence length 140
Comment crispr-associated protein, Cmr5 family [Thermomicrobium roseum DSM 5159]
Sequence
MSQPVHRTTQQRTLEQQRAARAWACVAAVKGTSYAAEYGQLAREAASLVQLHGLGQTLAF
LVSKRPDKPGQVNAHLHLARDLSRWVGTQLTGQELDDLREWIVRHASVAEYRRATLEALA
FLAWLKRFAEAELVKEGADA
Download sequence
Identical sequences B9L2U8
309801.trd_A0112 WP_012642478.1.69661 gi|221635518|ref|YP_002523394.1|NC_011961 gi|221635518|ref|YP_002523394.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]