SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|221635614|ref|YP_002523490.1| from Thermomicrobium roseum DSM 5159

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|221635614|ref|YP_002523490.1|
Domain Number 1 Region: 1-402
Classification Level Classification E-value
Superfamily Phase 1 flagellin 2.09e-96
Family Phase 1 flagellin 0.0000137
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|221635614|ref|YP_002523490.1|
Sequence length 402
Comment flagellin [Thermomicrobium roseum DSM 5159]
Sequence
MRIYNNVNAVNAQRNLSITGFALAKSIEKLSSGLRINRAADDAAGLSISEKLRAQIRGVM
QAMRNAQDGVSMIQTAEGALNEVHSMLQRMRELAVQAANDTLTTEDRRAIYQELDNLRVE
VDAIVARTSFNGKNLLDGTLVTTVAAGSEIKVGTTLTGGGETAHVFALDVSGAVPGRTYT
FSYNSTTDTLTLTRSGDNVSQSITISNIAAGGSQVLNFSALGIKLTVTSTGGITADNLGA
ALTAGATDTITTHNGGGSANMQVGPNSTHSFNVNFSDVRVSGTASAMTTLDSAITAFSTS
LSGLNSAQVTAAQNLINALDGAISYVNEVRSYLGAVQNRLEHAIANLGVQHENLTASESR
IRDVDMAKEMVIFTRNQILQQAGVAVLSQANAMPQSVLQLLR
Download sequence
Identical sequences B9L344
309801.trd_A0208 gi|221635614|ref|YP_002523490.1|NC_011961 WP_012642772.1.69661 gi|221635614|ref|YP_002523490.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]