SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|221635832|ref|YP_002523708.1| from Thermomicrobium roseum DSM 5159

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  gi|221635832|ref|YP_002523708.1|
Domain Number - Region: 7-120
Classification Level Classification E-value
Superfamily MFS general substrate transporter 0.0103
Family LacY-like proton/sugar symporter 0.05
Further Details:      
 
Domain Number - Region: 103-168
Classification Level Classification E-value
Superfamily NfeD domain-like 0.0235
Family NfeD domain-like 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|221635832|ref|YP_002523708.1|
Sequence length 184
Comment hypothetical protein trd_A0426 [Thermomicrobium roseum DSM 5159]
Sequence
MSLLAITYLVIALVGLAFLALTVLIGEIADIFDVGDDGIGPFNGKVIAVALTAFGATGLL
MTFFRVPVLWGALAAAGSGLAFGLAAWLLVALLYRQQATTEFSLQDLLGRTGEVTVPIAA
DQPGYVVISGPTGTRQYLARSSRGIPIPAGQLVRVSGLAGTVLLVEPLQQATAVEGRDAR
GESR
Download sequence
Identical sequences B9L3R2
309801.trd_A0426 gi|221635832|ref|YP_002523708.1|NC_011961 gi|221635832|ref|YP_002523708.1| WP_012642840.1.69661

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]