SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|221635454|ref|YP_002523330.1| from Thermomicrobium roseum DSM 5159

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|221635454|ref|YP_002523330.1|
Domain Number 1 Region: 148-461
Classification Level Classification E-value
Superfamily Phase 1 flagellin 1.28e-25
Family Phase 1 flagellin 0.029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|221635454|ref|YP_002523330.1|
Sequence length 468
Comment flagellar hook-associated protein FlgK [Thermomicrobium roseum DSM 5159]
Sequence
MVFRALETAFRGLMAQQRVVDTANHNIANANTPGFARQRVSLVPSMPYTVPAFNRSGLAG
QVGTGVLVASITRVRESVFDLQYRVQSQALGEASTLVDAYAQIEAVFNEPTEAGLGTLLD
RFWRAWQAVGNQPEDLAARAALVQDATTLATNLNRMRRQLTELQADTVTKLTLQVSEVNS
IAERLASLNQQIVAALATGQTPNDLMDQRDLLLDKLARFTGATIRPLPNGAVNIYLGGYP
LVDQDQWFPLSVQVSGGTASVLWQGTTSPVALERGSLQALLHLHNAVLPGLVQKLEDIRD
ALANEVNTLHMTGYGLSDLPGPPPGRPFFRITAGGELEVEPSLVADPQLIAAADAPGEPG
NNAIARQIAELRSKLVLNSGTATINDFYNTLVAEVGGASQTAQVTRDNQRALVEAIDRQR
QEIMAVSLDEEMANLIKYQQAYGAAARAITAVDEMLDRIINGMGLVGR
Download sequence
Identical sequences B9L5C1
309801.trd_A0048 gi|221635454|ref|YP_002523330.1| WP_012643143.1.69661 gi|221635454|ref|YP_002523330.1|NC_011961

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]