SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|221635756|ref|YP_002523632.1| from Thermomicrobium roseum DSM 5159

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|221635756|ref|YP_002523632.1|
Domain Number 1 Region: 211-353
Classification Level Classification E-value
Superfamily CBS-domain pair 2.53e-33
Family CBS-domain pair 0.0025
Further Details:      
 
Domain Number 2 Region: 352-440
Classification Level Classification E-value
Superfamily FAD-binding/transporter-associated domain-like 9.54e-18
Family CorC/HlyC domain-like 0.0015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|221635756|ref|YP_002523632.1|
Sequence length 445
Comment magnesium and cobalt efflux protein CorC [Thermomicrobium roseum DSM 5159]
Sequence
MPLLGEFVIILALLALNGYLAAAEIAVVSVRRAHLHALAEEGDAAARLVLRLLEQPSRLL
ATIQVGVTLATFFTSAVGAVSLAEPLGTALARLPIGRDQAAAMALVMVTVSLSFTSIVLG
ELVPKTLAVQHAERLALLSARPLAWLARIAAPIVWLLSGATNVVLRVLGVRHPGRVPSVT
REELLTLLDVAASEGAVSREEARLVEDAFEFGEITVRTVMIPRVDMVTVPADAPLEQAVE
QFFRTGLSRLPVVGESPDDVRGILYVKDVFRIVWQQPEARTQPCHRFARPAVYVPEHTPA
RQALRLLRMRRTKIAIVVDEFGGVAGLVTLEDLLERIVGEIADEFDPDYEPLREIAPGVL
EVDGRVSLDELLDRLELDEEELGAEFEAESVGGVITECLGRFPEVGDVVKLGSLELEVRS
MEGRRVRLVRVTYRPESREETGLEN
Download sequence
Identical sequences B9L3I6
gi|221635756|ref|YP_002523632.1| 309801.trd_A0350 WP_012642558.1.69661 gi|221635756|ref|YP_002523632.1|NC_011961

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]