SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|220915282|ref|YP_002490586.1| from Anaeromyxobacter dehalogenans 2CP-1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|220915282|ref|YP_002490586.1|
Domain Number 1 Region: 16-235
Classification Level Classification E-value
Superfamily Metallo-dependent phosphatases 6.78e-30
Family GpdQ-like 0.03
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|220915282|ref|YP_002490586.1|
Sequence length 251
Comment metallophosphoesterase [Anaeromyxobacter dehalogenans 2CP-1]
Sequence
MAEQQAPTQQQAERTFRLAAAADLHCRSDQHGRFRELVRMVNGEAEGLVLAGDLTDHGTL
DEAKTLAEVLSQLRVPCAAVLGNHDYEGGVVRDICRVLTEAKVTLLDGDHAVFDRRLGIA
GVKGFGGGFERGMLQAFGEPAIKAFVQEAVNEALKLEAALAQLEIQKKVVIMHYAPVFET
TEGEDLQLRPFLGSSRLIGPCEAFGARAVFHGHSHHGTLEARTPKGVPVYNVAMPLLRKL
MDDRRFRVFEL
Download sequence
Identical sequences B8J8S2
gi|220915282|ref|YP_002490586.1| WP_012631598.1.98204 455488.A2cp1_0161

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]