SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|220916163|ref|YP_002491467.1| from Anaeromyxobacter dehalogenans 2CP-1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|220916163|ref|YP_002491467.1|
Domain Number 1 Region: 4-289
Classification Level Classification E-value
Superfamily Metallo-dependent phosphatases 1.24e-37
Family GpdQ-like 0.0064
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|220916163|ref|YP_002491467.1|
Sequence length 309
Comment metallophosphoesterase [Anaeromyxobacter dehalogenans 2CP-1]
Sequence
MAVLRIAHLSDLHVRSPRGAEWRRILFNKRITGYANLIRQRGRVYRREYLAAVLAAAAAR
ADHVVVTGDVTNLALERELEEARSLLDAMARRVEVTVVPGNHDVYLASIQDGRRFPHHFG
AFLRGDLPDLALDLAAGPFPCVKLRGPAAIIGLSSAVPRPPFVASGRLGEAQLEALEAVL
AHPEVARRTPVVLLHHPPVDGRIRALQLRDGLVDADRLRAVLCRLGRGLVLFGHLHARVR
WRLPTAAGALQVIGASGAALDHPHPRVRAGFNSYDLRDDGSLAAVEAHVVAPDGRSVERV
ALPEAEAVA
Download sequence
Identical sequences B8JF44
455488.A2cp1_1050 gi|220916163|ref|YP_002491467.1| WP_012632394.1.98204

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]