SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|220916758|ref|YP_002492062.1| from Anaeromyxobacter dehalogenans 2CP-1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|220916758|ref|YP_002492062.1|
Domain Number 1 Region: 1-251
Classification Level Classification E-value
Superfamily Metallo-dependent phosphatases 2.04e-44
Family DNA double-strand break repair nuclease 0.0044
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|220916758|ref|YP_002492062.1|
Sequence length 270
Comment metallophosphoesterase [Anaeromyxobacter dehalogenans 2CP-1]
Sequence
MRLLFLSDTHLGHDLPARPRTSRPRRGAEFFESFEAALAPARAGEVDAVLHAGDLLYRSR
VPAWLSDAALAPLRAVADAGIPVLLLPGNHERGQLPHPLLACHRNLHVFDRPRTVVLEAG
GVRVAFAGFPYAREVRGRFAALLDAATAGAPSGDVRVLCLHHCVEGATVGPTDFTFRDGP
DVIPRSALPTGFAAVLCGHVHRHQVLRADGVPPVIYAGSTERTSSAEAGETKGIVLLWFS
EAGLERYRFRPLPLHAPPPRFRRGAPSPCG
Download sequence
Identical sequences B8J5P9
WP_012632924.1.98204 gi|220916758|ref|YP_002492062.1| 455488.A2cp1_1653

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]