SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|220917812|ref|YP_002493116.1| from Anaeromyxobacter dehalogenans 2CP-1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|220917812|ref|YP_002493116.1|
Domain Number 1 Region: 39-85,112-339
Classification Level Classification E-value
Superfamily Metallo-dependent phosphatases 1.64e-37
Family Purple acid phosphatase-like 0.0045
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|220917812|ref|YP_002493116.1|
Sequence length 356
Comment metallophosphoesterase [Anaeromyxobacter dehalogenans 2CP-1]
Sequence
MAVALVGAAGCCTCVDLDYTYRSGAARAPAAAPPLSPLLRVLHVADIGEPNCQQRAISDG
MAAAHRRAPFDLAVAPGDNVYNCGPDATLPGAAECRFADDGNTVAAGYAGPADPTFARFE
DAFAPLAGVPIHLALGNHDVATAGSCAVPGVEPATAARRKACLEVAHASPLWAMPGRHHL
VDRGPARFIVVDTNLLKGDYGGFTFADEEAFVAAAAAGCDARACFLVGHHPAVTAGSHHD
DATPEYLARVDRLLAAGQGRIRAWLAGHDHDLQHLRTPGGVDVLVSGNGSRARGAERFRE
ISAPGAELLFASVRWGFGVLEVGDGGWRYRFESDDGAALYCCAASGSGRCEPVACR
Download sequence
Identical sequences B8JDY5
WP_012633818.1.98204 455488.A2cp1_2713 gi|220917812|ref|YP_002493116.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]