SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|237794578|ref|YP_002862130.1| from Clostridium botulinum Ba4 str. 657

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|237794578|ref|YP_002862130.1|
Domain Number 1 Region: 88-153
Classification Level Classification E-value
Superfamily CO dehydrogenase ISP C-domain like 1.23e-26
Family CO dehydrogenase ISP C-domain like 0.00047
Further Details:      
 
Domain Number 2 Region: 5-82
Classification Level Classification E-value
Superfamily 2Fe-2S ferredoxin-like 3.41e-22
Family 2Fe-2S ferredoxin domains from multidomain proteins 0.001
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|237794578|ref|YP_002862130.1|
Sequence length 157
Comment xanthine dehydrogenase family protein iron-sulfur binding subunit [Clostridium botulinum Ba4 str. 657]
Sequence
MGLKRKIKLTVNDKKYEIEIDIRESLSEVLRSRLHLTGVKQGCLVGECGACTVLIDGVPT
DSCIYLAAWADGKTIKTIEGVQKNGELSEVQKAFIDEGAVQCGFCTPGLVLTTTALVESE
KDYTDDEIKREISGHLCRCTGYNKIFNATKKAILKRK
Download sequence
Identical sequences A0A0A2HLH5 A0A0E1L4G5
WP_003362994.1.20373 WP_003362994.1.28306 WP_003362994.1.34328 WP_003362994.1.49727 WP_003362994.1.5276 WP_003362994.1.57916 WP_003362994.1.59927 WP_003362994.1.69463 WP_003362994.1.95863 WP_003362994.1.9587 WP_003362994.1.99682 515621.CLJ_B1335 gi|237794578|ref|YP_002862130.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]