SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|238923857|ref|YP_002937373.1| from Eubacterium rectale ATCC 33656

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|238923857|ref|YP_002937373.1|
Domain Number 1 Region: 16-80
Classification Level Classification E-value
Superfamily L28p-like 3.85e-26
Family Ribosomal protein L31p 0.00023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|238923857|ref|YP_002937373.1|
Sequence length 81
Comment ribosomal protein L31 [Eubacterium rectale ATCC 33656]
Sequence
MKLKKYDKNIKEVKIMREGIHPDYYQATVTCNCGNTFVTGSTKPEIHVEICSKCHPFYTG
QQKANQARGRIEQFNKKYGMK
Download sequence
Identical sequences C4Z908
515619.EUBREC_1485 gi|238923857|ref|YP_002937373.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]