SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|238925047|ref|YP_002938563.1| from Eubacterium rectale ATCC 33656

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|238925047|ref|YP_002938563.1|
Domain Number 1 Region: 60-104
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 0.00000266
Family TrmB-like 0.071
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|238925047|ref|YP_002938563.1|
Sequence length 113
Comment hypothetical protein EUBREC_2699 [Eubacterium rectale ATCC 33656]
Sequence
MNFEFMTIDTPLPPCVPFPRALTGFPVSSTAKVMYCRMLDAMLSNGQEDENGILFVCFPV
TAIAAVLSRSSMTVKRSLNELETAGLIMRVRQGVGEPNRIYVLIPGEEDAALA
Download sequence
Identical sequences C4ZER6
388666 WP_012741688.1.32465 gi|238923201|ref|YP_002936716.1| gi|238925047|ref|YP_002938563.1| 515619.EUBREC_0796 515619.EUBREC_2699

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]