SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|333977512|ref|YP_004515457.1| from Desulfotomaculum kuznetsovii DSM 6115

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|333977512|ref|YP_004515457.1|
Domain Number 1 Region: 30-486
Classification Level Classification E-value
Superfamily Type II DNA topoisomerase 2.62e-182
Family Type II DNA topoisomerase 0.000000000106
Further Details:      
 
Domain Number 2 Region: 498-805
Classification Level Classification E-value
Superfamily GyrA/ParC C-terminal domain-like 1.7e-112
Family GyrA/ParC C-terminal domain-like 0.00000896
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|333977512|ref|YP_004515457.1|
Sequence length 808
Comment DNA gyrase subunit A [Desulfotomaculum kuznetsovii DSM 6115]
Sequence
MSVNIGKVIPIDINEEMKHSYLDYAMSVIVGRALPDVRDGLKPVHRRILYAMHQLGLTPD
RPHRKSAHIVGEVMSKFHPHGDMAIYDALVRMAQDFASRYPLVDGHGNFGSVDGDAPAAM
RYTEARMARITMAMLADIEKNTVDFLPNYDGSNEEPKVLPARIPNLLVNGSSGIAVGMAT
NIPPHNLGEVIDGVIRLIDNPDITIPELMQVIKGPDFPTGGKIMGRQGIREAYQTGRGAI
KVRAQATVEKIGGGKSAIIVHEIPFMVNKARLIEKIAELVREKKIDGITDLRDESDRRGM
RIVIELRRDAKPRVILNQLYKHTQMQETFGVIMLALVDGQPQVLNLRQMLGHYLEHQKEV
VVRRTRFDLEKAEARAHIVEGLRIALDHIDEVINTIRASRTVEIAKNALMEKFGLSEKQA
QAILDMRLQRLTGLERDKLEEEYKELLDRIAYLRGVLADERKVLQIIRDELTEMRQKFAD
PRRTVISDEDTTLEAEDLIPEEEVVITITNQGYIKRMPLDTYRSQKRGGRGITAMGTKEE
DFVRHLFITSTHHYFLFFSNRGKVYRLKVHEIPEAGRQAKGTALVNLIYIGPQERITAVI
PVREFSNGLYLFMATRFGVVKKTQLEQFDTSRRDGIIAIKLDDQDELVEVKLTSGREEII
LGTRQGLAIRFPEEEVHPYGRTARGVKGITLQPGDTVVAMDIVRPDGDVLVVTANGYGKR
TPVSDYRLQSRGGKGIISARVTGRNGPVVAMQVVKPDEEIMVISAEGIIIRLKASDISTM
GRATQGVMLMRLAPGDKLVAAALVSAEE
Download sequence
Identical sequences F6CIH8
gi|333977512|ref|YP_004515457.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]