SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|333977605|ref|YP_004515550.1| from Desulfotomaculum kuznetsovii DSM 6115

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|333977605|ref|YP_004515550.1|
Domain Number 1 Region: 807-1033
Classification Level Classification E-value
Superfamily Multidrug efflux transporter AcrB transmembrane domain 7.19e-55
Family Multidrug efflux transporter AcrB transmembrane domain 0.0000922
Further Details:      
 
Domain Number 2 Region: 288-487
Classification Level Classification E-value
Superfamily Multidrug efflux transporter AcrB transmembrane domain 2.49e-45
Family Multidrug efflux transporter AcrB transmembrane domain 0.0000653
Further Details:      
 
Domain Number 3 Region: 40-132
Classification Level Classification E-value
Superfamily Multidrug efflux transporter AcrB pore domain; PN1, PN2, PC1 and PC2 subdomains 1.57e-23
Family Multidrug efflux transporter AcrB pore domain; PN1, PN2, PC1 and PC2 subdomains 0.00082
Further Details:      
 
Domain Number 4 Region: 136-180,266-322
Classification Level Classification E-value
Superfamily Multidrug efflux transporter AcrB pore domain; PN1, PN2, PC1 and PC2 subdomains 1.62e-19
Family Multidrug efflux transporter AcrB pore domain; PN1, PN2, PC1 and PC2 subdomains 0.0099
Further Details:      
 
Domain Number 5 Region: 181-263
Classification Level Classification E-value
Superfamily Multidrug efflux transporter AcrB TolC docking domain; DN and DC subdomains 0.00000000000000353
Family Multidrug efflux transporter AcrB TolC docking domain; DN and DC subdomains 0.009
Further Details:      
 
Domain Number 6 Region: 723-808
Classification Level Classification E-value
Superfamily Multidrug efflux transporter AcrB TolC docking domain; DN and DC subdomains 0.000000000000017
Family Multidrug efflux transporter AcrB TolC docking domain; DN and DC subdomains 0.0064
Further Details:      
 
Domain Number 7 Region: 561-663
Classification Level Classification E-value
Superfamily Multidrug efflux transporter AcrB pore domain; PN1, PN2, PC1 and PC2 subdomains 0.0000000000384
Family Multidrug efflux transporter AcrB pore domain; PN1, PN2, PC1 and PC2 subdomains 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|333977605|ref|YP_004515550.1|
Sequence length 1046
Comment acriflavin resistance protein [Desulfotomaculum kuznetsovii DSM 6115]
Sequence
MRLPEFSVKQPVATLMLFLAVIILGALSLTRLPIDLLPDIEPPVVSVLTAWPGASASDVE
TEITEHIEDQLNMVNNLDTLTSKSLDNLSLVSCKFEWGTDLEEATNDIRDKLDLAKRKLP
DDAEEPLIFKFSSASIPILVMTVTGDTSWPRLYYLTEKKIADELKRVPGVGAIQLYGGME
RQINVHFDLQKIDGYHLNLLQVKQVLAAENLNLPAGSIKSGTQEYFVRIPARYRDVEEIK
NTVVGYFSGRPVYLKDVAEVEDAYKEQTVNGWADGKKAIVLILQKQAGKNTVKVVQGVKD
KLKEIEKNLPTDVKINTVMDSSEDILRSVKTLQDELLRAILLVIIVTILFLRRVKAAAII
ALTIPFSLLAAFIPLSLFGHTINLISLMSLAIACGLVVDDGIVILENITRHLERGGRPKT
SAIYGASEVGMAVTASTMTVVVVFVPLMFVGGITGTLFKELGFVIVVTLLASLFTALSMT
PMLASKWLGAGNKESAAKESLGSKFYTTIEKYLVLIEDAYGRVLTWALAHKKTVITLAVS
IFASSLALVPFIGTSFVPDMDSGDVNIEFRLPEGTRIEETNRVIEKMLQTINKVVKPEEL
RHSYAFDGQSEEGFGAALGMDEGPNVGMIGFKLVDRDKRERSTHDIASKLREQLERIPGI
SRMKVTATSPISSLMMGGGKPIIIEVAGPDLKTNLEVAEQVKKIVKEVPGTVDVSLSQKD
PRPELWIEVDRQKAASFGLNIATIAGAVRNYFYGDNPTEFRDAGDSFDIFTRLSEADKNR
LENLPEVSIFTPDGRMIKLKNIAEIKSGEGPVEIERKNRQRIVKVEADRYGRSLGEITSD
IRDALKNMDIPPGVSVSFGGEVEEQQKAFKDLSLLLVLGIVLVYMVMASLYGNFRDPLIV
MFSVPFALTGVFYAFYLTGTTLSLVSFMGIIMLTGIVVKNAIILVDYTHLLQSRGQPLRE
AITNAGRNRLRPILMTTAAMFFGMLPLAISRGVGAELWNPLGITMMGGLAVSTLVTLVLI
PTVYCLFEERKLRKASGIQKVSVKFS
Download sequence
Identical sequences F6CQ92
gi|333977605|ref|YP_004515550.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]