SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|333977641|ref|YP_004515586.1| from Desulfotomaculum kuznetsovii DSM 6115

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|333977641|ref|YP_004515586.1|
Domain Number 1 Region: 2-139
Classification Level Classification E-value
Superfamily YaeB-like 5.49e-45
Family YaeB-like 0.00029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|333977641|ref|YP_004515586.1|
Sequence length 141
Comment hypothetical protein Desku_0141 [Desulfotomaculum kuznetsovii DSM 6115]
Sequence
MELVPVGVIHSPYRVPGEAPHQGRFSDRTAELEIYPQFMEGLKDVEHATHLIVLYWCHLA
RRDTLQTRTPFGPEIRGVFACRSPSRPNPIAFCVAELLEVKENRLLVRGVDALDGSPLID
IKPYSSDVDSVSGARIGWFKK
Download sequence
Identical sequences F6CLP6
gi|333977641|ref|YP_004515586.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]