SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|333978464|ref|YP_004516409.1| from Desulfotomaculum kuznetsovii DSM 6115

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|333978464|ref|YP_004516409.1|
Domain Number 1 Region: 169-359
Classification Level Classification E-value
Superfamily Methylesterase CheB, C-terminal domain 3.01e-56
Family Methylesterase CheB, C-terminal domain 0.0000123
Further Details:      
 
Domain Number 2 Region: 9-117
Classification Level Classification E-value
Superfamily CheY-like 3.27e-28
Family CheY-related 0.00026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|333978464|ref|YP_004516409.1|
Sequence length 361
Comment response regulator receiver modulated CheB methylesterase [Desulfotomaculum kuznetsovii DSM 6115]
Sequence
MGGAWKSQRIRVLIADDSALMRRILKEMLSSDPQIEVVDTARDGEEAVVKSLEQRPDVVT
MDVNMPKMDGLTALQHILLKAPCAVVMVSSLTQEGALTTLEALELGAVDFVAKPDGTVSL
GIRHLREEIIAKVKAAARARVRLRRPEKARVLGPRLPGPRLKPDPGQHSLKVVVIGVSTG
GPRTLMDILPYLPQDLPAAVLVVQHMPQNFTAPFAQRLNQSCRVAVKEAADGDELAPGKV
LVAKGGYHLKVERKPGGVLVARLSRQPADVLYMPSVNVTMQSVLEKVPPRNVVGVLLTGM
GDDGADMMVEIRRQGGYTIAEAEETAVVWGMPREAYLRGGAEVVAPSYLIAEQIIKGVKR
D
Download sequence
Identical sequences F6CK18
gi|333978464|ref|YP_004516409.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]