SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|333978658|ref|YP_004516603.1| from Desulfotomaculum kuznetsovii DSM 6115

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|333978658|ref|YP_004516603.1|
Domain Number 1 Region: 114-215
Classification Level Classification E-value
Superfamily Cell-division inhibitor MinC, C-terminal domain 2.62e-27
Family Cell-division inhibitor MinC, C-terminal domain 0.0006
Further Details:      
 
Weak hits

Sequence:  gi|333978658|ref|YP_004516603.1|
Domain Number - Region: 38-92
Classification Level Classification E-value
Superfamily Adenine nucleotide alpha hydrolases-like 0.0795
Family N-type ATP pyrophosphatases 0.018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|333978658|ref|YP_004516603.1|
Sequence length 224
Comment septum site-determining protein minC [Desulfotomaculum kuznetsovii DSM 6115]
Sequence
MTAEIEICFRGNKKGLGKVPRELVSIKGTREGLVILLDPNREFEDIKLHLKRKMESSRGF
FRGARFTVYGQTITGYQRTELENICRQYGLIPSPEISWPFEKKKAASPGEPARLVQCALR
SGQEIRHRGSVVIVGNVHPGAQVIADGSVIIMGSCRGTIHAGAGGNNTATITALKFEPIR
LSIAGVTADPATIPQNSLFPLTARLEKGRIIFSSYRSKATYPIF
Download sequence
Identical sequences F6CJI2
gi|333978658|ref|YP_004516603.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]