SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|333978761|ref|YP_004516706.1| from Desulfotomaculum kuznetsovii DSM 6115

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|333978761|ref|YP_004516706.1|
Domain Number 1 Region: 7-272
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 4.18e-87
Family Protein kinases, catalytic subunit 0.000000703
Further Details:      
 
Weak hits

Sequence:  gi|333978761|ref|YP_004516706.1|
Domain Number - Region: 474-536
Classification Level Classification E-value
Superfamily Penicillin-binding protein 2x (pbp-2x), c-terminal domain 0.0102
Family Penicillin-binding protein 2x (pbp-2x), c-terminal domain 0.01
Further Details:      
 
Domain Number - Region: 334-380
Classification Level Classification E-value
Superfamily Penicillin-binding protein 2x (pbp-2x), c-terminal domain 0.0209
Family Penicillin-binding protein 2x (pbp-2x), c-terminal domain 0.022
Further Details:      
 
Domain Number - Region: 403-465
Classification Level Classification E-value
Superfamily Penicillin-binding protein 2x (pbp-2x), c-terminal domain 0.0288
Family Penicillin-binding protein 2x (pbp-2x), c-terminal domain 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|333978761|ref|YP_004516706.1|
Sequence length 620
Comment serine/threonine protein kinase with PASTA sensor(s) [Desulfotomaculum kuznetsovii DSM 6115]
Sequence
MIGRQLGNRYEILEQLGGGGMAVVYKGRDTFLNRLVTIKILRPEFSSDKDFTRRFRREAQ
AVASLSHPNIVSIYDVGQEDDIQYLVMEYVDGEDLKTVIRREGALPPEKAVQIAFQVLEA
LEHAHENNIVHRDIKPHNILITKSGRAKLTDFGIAREATAATVTQTDTIVGSVHYLSPEQ
ARGELAGPQSDLYSLGVVLYEMLTGSVPFAGDSPIAVAIKHIQEEPEPPSRRNPAVSPGL
EQVILRAMQKNPQSRFASAREMARHLENLFARDGEEVTRFIPLDEMATRVLKPVEKPRRR
LRPAGWVALTLLLLALLAGGAYALNSYLIGPPPVTVPSVINKELSEAQKILADLGLRVKV
RKEHHPRIPEGFVIDQDIGPADAPVKPPRDITLTVSLGPDLREVPDLYRLSLEDARIRLT
ERGLVLAEQVQKGYDDNVPPDLIFQQSPAAGERVAPNTPVTVYLSLGPKPRQSRVPNLIG
LTLDQARAKLAENNLSLDENVEWVESTDYFQNQVVSQDPAPNGMVEQGTSVKVTLSKGPG
PVPREARVKVPLDNDGQAHQVKIVINDVRGTTLAYVNTHQPGETVLTTVRYYGQATIQVY
VDNKLVKQKSLQEGKNDDDS
Download sequence
Identical sequences F6CKW6
gi|333978761|ref|YP_004516706.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]