SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|333978997|ref|YP_004516942.1| from Desulfotomaculum kuznetsovii DSM 6115

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|333978997|ref|YP_004516942.1|
Domain Number 1 Region: 310-601
Classification Level Classification E-value
Superfamily Methyl-accepting chemotaxis protein (MCP) signaling domain 9.55e-72
Family Methyl-accepting chemotaxis protein (MCP) signaling domain 0.0000132
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|333978997|ref|YP_004516942.1|
Sequence length 601
Comment methyl-accepting chemotaxis sensory transducer [Desulfotomaculum kuznetsovii DSM 6115]
Sequence
MKRTRKGKKERKETTKEFLQNCWDYKRCPEEKKRACPAYIEKRGRDCWLVDYTLCDTEGQ
SSAAEKISLCRRCDFYRRANRQGIQIRGKLLMGFGLVLLLTLALGLLSLAQLNAINESYT
DLMEHKAANMSKVQGILIRYEKTALDLRGYMLTGNPSYLNAYLVETKHLQRDISELAKHL
QSNAERSLHMALQAAHADSEKYAQTVIRFRQNNQMEELTQYLQTSGDIINAVIYAGQALV
DEEQRLLNLGKQENARRVKHAIALVPTMIVLALLVGLGVSLYMSRSIANPLVRIEKRAAR
IAAGDLTGEEVSVKTRDEVGRMAQAFNQMAGSLKQMVQELRDKAQTLSSASQQLTATAEE
TAAMANETAATISQVATSTRQVSDNAQEMSRTAAMASQHANEGTRAIMQITAQMENIARV
SEAASRAMESLKSKSQNISAMVELITQIADQTNLLALNAAIEAARAGEHGRGFAVVAEEV
RNLAEQSARAAQEIQQTIESIQQETKEAVDATETSAREVKAGNQVVTEVKHSLQEIIRSV
QELSSRVQEMAAAAQEISSGVQNVTAAAEEQSSAMEELSTTAESLSSIASELQHLSSRFK
V
Download sequence
Identical sequences F6CJM2
gi|333978997|ref|YP_004516942.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]