SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|333979437|ref|YP_004517382.1| from Desulfotomaculum kuznetsovii DSM 6115

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|333979437|ref|YP_004517382.1|
Domain Number 1 Region: 2-240
Classification Level Classification E-value
Superfamily Class II aaRS and biotin synthetases 7.95e-98
Family Class II aminoacyl-tRNA synthetase (aaRS)-like, catalytic domain 0.0000000519
Further Details:      
 
Domain Number 2 Region: 241-459
Classification Level Classification E-value
Superfamily Putative anticodon-binding domain of alanyl-tRNA synthetase (AlaRS) 1.44e-67
Family Putative anticodon-binding domain of alanyl-tRNA synthetase (AlaRS) 0.00000243
Further Details:      
 
Domain Number 3 Region: 552-710
Classification Level Classification E-value
Superfamily ThrRS/AlaRS common domain 2.75e-54
Family Threonyl-tRNA synthetase (ThrRS), second 'additional' domain 0.034
Further Details:      
 
Domain Number 4 Region: 453-552
Classification Level Classification E-value
Superfamily Translation proteins 0.0000000000000742
Family AlaX-M N-terminal domain-like 0.03
Further Details:      
 
Weak hits

Sequence:  gi|333979437|ref|YP_004517382.1|
Domain Number - Region: 731-761
Classification Level Classification E-value
Superfamily Mitotic arrest deficient-like 1, Mad1 0.0248
Family Mitotic arrest deficient-like 1, Mad1 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|333979437|ref|YP_004517382.1|
Sequence length 878
Comment alanyl-tRNA synthetase [Desulfotomaculum kuznetsovii DSM 6115]
Sequence
MTGKEIREKFLKFFEARGHRILPSASLIPTNDPSLLWTAAGMVPFKPYFTGAAKPEVRRV
TTCQKCLRTPDIESVGRTARHHTFFEMLGNFSFGDYFKEKAIPWAWEFTTRVLGLPEEKL
WISIYLDDDEAFDIWHREVGVPAERIVRMGKDTNFWEIGVGPCGPCSEIYVDLGEERGCG
SAGCGVGCDCDRYLEIWNLVFIQFFRDEAGNYTPLASKGIDTGMGLERVASVLQGVPSNF
DTDLFREIMDFTAGLAGVKYGAGSKTDMALKVIADHCRAVTFAISDGALPSNEGRGYVLR
RLLRRAVRFGRVLGLHEPFLYQVAGAVIKQMAGAYPELPANQGHVLKIIRSEEERFGETL
AQGTEILNRLVQEARAAGSTVIRGEDAFRLYDTYGFPLELTREMAAEEGLTVDEEAFARA
MEEQRERARRARQETEYLSEKDAFYQVLRDKLGETRFVGYDTLEARGKVLALLKEGRPVD
KAVAGEEVEFILDITPCYAESGGQVSDHARVSAPELEVQVLEVSRPVEGLIVHRGKVQNG
VLKENDSILVVVDGKRRRDTARNHSATHLLHKALKEVLGPHVNQAGSLVEPDRLRFDFTH
YAPVSPEELHRIEEMVNQAVLENLPVQTFFTSLEEAQAMGAVALFGEKYGEQVRVVKMGD
FSLELCGGTHVRSTAEIGLFKLISEGSVGAGLRRVEAVTGAGALRYVRAREEQLARIASL
VRATPAEVVHRVESLVKEVKELERESEGLRARLARYEVQTLLEQVKDLDGAKFLAAKTSA
PDMDSLRAMVDLLRERLGSGVILLASPVGERVNLVAAVTKDLLPRGLHAGKLVKEVASML
GGGGGGRPDMAQAGGKDASRLQEALQKAYTVAAGQLKS
Download sequence
Identical sequences F6CL95
gi|333979437|ref|YP_004517382.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]