SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|333979450|ref|YP_004517395.1| from Desulfotomaculum kuznetsovii DSM 6115

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|333979450|ref|YP_004517395.1|
Domain Number 1 Region: 239-529
Classification Level Classification E-value
Superfamily Methyl-accepting chemotaxis protein (MCP) signaling domain 1.83e-70
Family Methyl-accepting chemotaxis protein (MCP) signaling domain 0.0000233
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|333979450|ref|YP_004517395.1|
Sequence length 530
Comment methyl-accepting chemotaxis sensory transducer [Desulfotomaculum kuznetsovii DSM 6115]
Sequence
MRLNIMGKLMLGFGAVLLLMLGTCLFLIMQMRNMNNDYTGLIKIKALAYGESFEALAHYN
AAAAYLRQYILTREEDLASRYQQSVKNGDDKLGKIAPLLERAEEKDLLQKFQAQAADFKQ
EADQIISLVKASKSASEGERAVIEERLAQIESRSTVVRNLISAGTALADFEKQVLDDDAN
RTLSRANRDINISIILVAVTIVLGLILALFIARMITAPIRLLDAGAAKIAAGDLSGEGIN
LKTKDEAGRLAESFNTMLYNLKEIVRHLQEKSDVLTSSASELSASAQNVSAGASETASTI
SQVAGTVEQVTSNVSHIAEMAELAAGHAREGSEGIRNIRMQMDAIQQAAAGTGEVIRNLY
ETTSRITQIVELITHITDQTNLLALNAAIEAARAGEHGRGFAVVAEEVRKLAGQSAGAAK
EIYALITTIQQESQKAVQSMEMSVTRVENGVQVVEEVGVTFERIIEAVQKLAGEIREVAE
AAEEMSSAVQNVAAAAEEQTAAMEEVSSTTQNLAGLAGELDTLAGHFKLA
Download sequence
Identical sequences F6CLA8
gi|333979450|ref|YP_004517395.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]