SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|333979646|ref|YP_004517591.1| from Desulfotomaculum kuznetsovii DSM 6115

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|333979646|ref|YP_004517591.1|
Domain Number 1 Region: 3-179
Classification Level Classification E-value
Superfamily Macro domain-like 1.06e-66
Family Macro domain 0.00000419
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|333979646|ref|YP_004517591.1|
Sequence length 185
Comment Appr-1-p processing domain-containing protein [Desulfotomaculum kuznetsovii DSM 6115]
Sequence
MEVRLGSTLLRLMVGDITQQDTEAIVNAANSSLMGGGGVDGAIHRAGGPQILEECKQIVA
RQGSLPTGQAVITTGGKLKARYVIHTVGPIWSGGNRGEDELLHNAYYNSLSLAREKGIKS
ISFPSISTGAYRFPIERAATIALKTVRDFILENDFFTEVRFVLFREDDFKVYQRAWEKLS
GGVEG
Download sequence
Identical sequences F6CMT6
gi|333979646|ref|YP_004517591.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]