SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|333979755|ref|YP_004517700.1| from Desulfotomaculum kuznetsovii DSM 6115

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|333979755|ref|YP_004517700.1|
Domain Number 1 Region: 166-562
Classification Level Classification E-value
Superfamily beta-lactamase/transpeptidase-like 9.73e-112
Family beta-Lactamase/D-ala carboxypeptidase 0.0000645
Further Details:      
 
Domain Number 2 Region: 51-215
Classification Level Classification E-value
Superfamily Penicillin binding protein dimerisation domain 1.57e-41
Family Penicillin binding protein dimerisation domain 0.0012
Further Details:      
 
Domain Number 3 Region: 640-693
Classification Level Classification E-value
Superfamily Penicillin-binding protein 2x (pbp-2x), c-terminal domain 0.00000000301
Family Penicillin-binding protein 2x (pbp-2x), c-terminal domain 0.0067
Further Details:      
 
Domain Number 4 Region: 577-630
Classification Level Classification E-value
Superfamily Penicillin-binding protein 2x (pbp-2x), c-terminal domain 0.00000209
Family Penicillin-binding protein 2x (pbp-2x), c-terminal domain 0.018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|333979755|ref|YP_004517700.1|
Sequence length 696
Comment peptidoglycan glycosyltransferase [Desulfotomaculum kuznetsovii DSM 6115]
Sequence
MTPPKTSFSRRMGILLLMVLLAFSYLIVRLFLVQIVWGGHLRQEATNIRTRDIILQPNRG
NIYDRHHNLLVTSIPSYSVYAHPDQIKDPGSIADKVAAILGIRREEIYEKLAARGPFVWL
QHGVEFDRAKKLQGISGLGFVESSARFYKQGNLAAALLGFVGDDNQGLNGLEKSYDRELR
GTPGKMVLEIDAQGRQIPQSAVLVKRSEAGNNLVLTLDQTIQYYVERELDRIVSTYQPKW
AAILVMDPKTGEILGMGDRPTFDPSRWQKFPREVWEKNPVTLYTYEPGSTFKMIVAAAAL
EEGVVRPTDWFNDPGYAVVNGRRIYCWDRKGHGPQSFAQAVGNSCNPVFVQVGLRLGKER
FYKYVRGFGFGTPTGIDLPGEESGVVLPEQKASELDLATMAIGQSIAVTPIQLLTAVSAI
ANGGYLMQPHVVRAVEDASGKTIREISPRVIRQVISRETARQLSGLLEKVVLEGTGKRAL
VEGYRVAGKTGTAQVPGPGGYVEGKYVASFAGFAPADDPRIAVLVVVGEPRGQEYHGGEV
AAPAFGAVVRDTLRYLGVPETPGRKSQDAPPEQDELVVVPNVVGFPVADARWLLEERGLR
SWSSGKTGLVTGQEPSAGKRVPPGTTVSLQIAASKAPERLVVPDLSGLTVKKAGSILEEL
GLKFKASGSGVAVRQRPEAGSRVAPGTTVFVEFAPP
Download sequence
Identical sequences F6CHB5
gi|333979755|ref|YP_004517700.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]