SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|333979887|ref|YP_004517832.1| from Desulfotomaculum kuznetsovii DSM 6115

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|333979887|ref|YP_004517832.1|
Domain Number 1 Region: 68-232
Classification Level Classification E-value
Superfamily Chorismate lyase-like 3.77e-16
Family UTRA domain 0.0075
Further Details:      
 
Domain Number 2 Region: 7-62
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 0.00000000000169
Family GntR-like transcriptional regulators 0.022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|333979887|ref|YP_004517832.1|
Sequence length 243
Comment GntR family transcriptional regulator [Desulfotomaculum kuznetsovii DSM 6115]
Sequence
MAEQFSWQEIAAILRERILSGQLKPGQPFPTNKELINEFGVYVSTVQNAVNALIREGLVV
TSGPGNKRRIVRPLLERSVRRGGFLTEFGPRARLEILELKIVRSPRKLPAAVLKEMDPPV
LRYLTRQWRDEIPVALSDVYIPGVVPLKELKSLISDPGTDLYRAMESLGMRADTCEESLI
AGGSTPEEQQILNGAPVVVRITRKVYNKDGRLLELCFLTNRADCYEFLYRFPFEAQENND
KLT
Download sequence
Identical sequences F6CLE4
gi|333979887|ref|YP_004517832.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]