SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|333980010|ref|YP_004517955.1| from Desulfotomaculum kuznetsovii DSM 6115

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|333980010|ref|YP_004517955.1|
Domain Number 1 Region: 278-448
Classification Level Classification E-value
Superfamily MgtE membrane domain-like 5.62e-48
Family MgtE membrane domain-like 0.0000384
Further Details:      
 
Domain Number 2 Region: 133-269
Classification Level Classification E-value
Superfamily CBS-domain pair 1.39e-35
Family CBS-domain pair 0.00000709
Further Details:      
 
Domain Number 3 Region: 6-131
Classification Level Classification E-value
Superfamily MgtE N-terminal domain-like 6.54e-29
Family MgtE N-terminal domain-like 0.0011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|333980010|ref|YP_004517955.1|
Sequence length 450
Comment magnesium transporter [Desulfotomaculum kuznetsovii DSM 6115]
Sequence
MSRDREEVRRAVLSCLEEGSTDRLRQCLKDLHPADIAEVLPDISLGQQVKVLRVMEPDRA
AQVIFELDREKLPTLMECLGLQRTADILSAMFTDDAADLLGDLPGDLRQKLLGLLEAHEA
RDLKELLTYGEETAGGIMTTEYVAIQKDITAGQAIEVLRENAPDAETVYYVYVVDDQNHL
VGVLSLRELILAAPYMRIEDIMRRKVISVNVNTDQEEVARLVAKYDFLAVPVVSDAGELL
GIVTVDDVLDVIEREATEDMMRMAATIDSEGEDPDASPVKRALRRLPWLVGLLFGELVAG
HVIEGFSETLQHLTALAFFMTAIAGGTGNAATQSLAVVVRGIATGEVDPSQILKVIWKEA
QVGMWVGLVCGLVVGFFAFVWQSSPSLGLVVGGALALSITVSTILGSFVPVIINRIGVDP
ALASGPFITTLMDVSSMFIYFTLATLILVR
Download sequence
Identical sequences F6CHJ4
gi|333980010|ref|YP_004517955.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]